SCOPe 2.08: Domain d3rwob_: 3rwo B:

Lineage for d3rwob_ (3rwo B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189771] (4 PDB entries)

8. Domain d3rwob_: 3rwo B: [185200]
   automated match to d2f9la1
   complexed with gdp, mg

Details for d3rwob_

PDB Entry: 3rwo, 1.7 Å

PDB Description: Crystal structure of YPT32 in complex with GDP

PDB Compounds: (B:) GTP-binding protein YPT32/YPT11

SCOPe Domain Sequences for d3rwob_:

Sequence; same for both SEQRES and ATOM records:

>d3rwob_ c.37.1.8 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydydylfkivligdsgvgksnllsrfttdefnieskstigvefatrtievenkkikaqi
wdtagleryraitsayyrgavgalivydisksssyencnhwltelrenaddnvavglign
ksdlahlravptdeaknfamenqmlftetsalnsdnvdkafrelivaifqmv

Timeline for d3rwob_:

• d3rwob_ first appeared in SCOPe 2.01
  
• d3rwob_ appears in SCOPe 2.07