Lineage for d3rw9a_ (3rw9 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129722Family c.66.1.17: Spermidine synthase [69557] (3 protein domains)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 2129767Protein automated matches [190432] (5 species)
    not a true protein
  7. 2129768Species Human (Homo sapiens) [TaxId:9606] [189789] (1 PDB entry)
  8. 2129769Domain d3rw9a_: 3rw9 A: [185196]
    automated match to d2o05a1
    complexed with dsh

Details for d3rw9a_

PDB Entry: 3rw9 (more details), 2 Å

PDB Description: Crystal Structure of human Spermidine Synthase in Complex with decarboxylated S-adenosylhomocysteine
PDB Compounds: (A:) spermidine synthase

SCOPe Domain Sequences for d3rw9a_:

Sequence, based on SEQRES records: (download)

>d3rw9a_ c.66.1.17 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
airegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktygnvlvldgviqcter
defsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesvvqceidedviqvsk
kflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpmgpaeslfkesyyqlmk
talkedgvlccqgecqwlhldlikemrqfcqslfpvvayayctiptypsgqigfmlcskn
pstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkalnd

Sequence, based on observed residues (ATOM records): (download)

>d3rw9a_ c.66.1.17 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
airegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktygnvlvldgviqcter
defsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesvvqceidedviqvsk
kflpgmaigyssskltlhvgdgfefmkqnqdafdviitdsgpaeslfkesyyqlmktalk
edgvlccqgecqwlhldlikemrqfcqslfpvvayayctiptypsgqigfmlcsknpstn
fqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkalnd

SCOPe Domain Coordinates for d3rw9a_:

Click to download the PDB-style file with coordinates for d3rw9a_.
(The format of our PDB-style files is described here.)

Timeline for d3rw9a_: