SCOPe 2.07: Domain d3ruyb_: 3ruy B:

Lineage for d3ruyb_ (3ruy B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [189194] (4 PDB entries)

8. Domain d3ruyb_: 3ruy B: [185194]
   automated match to d1gbna_

Details for d3ruyb_

PDB Entry: 3ruy, 2.65 Å

PDB Description: Crystal Structure of the Ornithine-oxo acid transaminase RocD from Bacillus anthracis

PDB Compounds: (B:) ornithine aminotransferase

SCOPe Domain Sequences for d3ruyb_:

Sequence; same for both SEQRES and ATOM records:

>d3ruyb_ c.67.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 261594]}
kdiieltdtygannyhplpiviskaegvwvedpegnrymdllsaysavnqghrhpkiina
lidqanrvtltsrafhsdqlgpwyekvakltnkemvlpmntgaeavetaiktarrwaydv
kkveanraeiivcednfhgrtmgavsmssneeykrgfgpmlpgiivipygdlealkaait
pntaafilepiqgeaginippagflkealevckkenvlfvadeiqtglgrtgkvfacdwd
nvtpdmyilgkalgggvfpiscaaanrdilgvfepgshgstfggnplacavsiaalevle
eeklterslqlgeklvgqlkeidnpmitevrgkglfigielneparpyceqlkaagllck
ethenviriapplviseedlewafqkikavls

Timeline for d3ruyb_:

• d3ruyb_ first appeared in SCOPe 2.01
  
• d3ruyb_ appears in SCOPe 2.06
  
• d3ruyb_ appears in the current release, SCOPe 2.08