Lineage for d3ruyb_ (3ruy B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132305Species Bacillus anthracis [TaxId:261594] [189194] (4 PDB entries)
  8. 2132313Domain d3ruyb_: 3ruy B: [185194]
    automated match to d1gbna_

Details for d3ruyb_

PDB Entry: 3ruy (more details), 2.65 Å

PDB Description: Crystal Structure of the Ornithine-oxo acid transaminase RocD from Bacillus anthracis
PDB Compounds: (B:) ornithine aminotransferase

SCOPe Domain Sequences for d3ruyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ruyb_ c.67.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 261594]}
kdiieltdtygannyhplpiviskaegvwvedpegnrymdllsaysavnqghrhpkiina
lidqanrvtltsrafhsdqlgpwyekvakltnkemvlpmntgaeavetaiktarrwaydv
kkveanraeiivcednfhgrtmgavsmssneeykrgfgpmlpgiivipygdlealkaait
pntaafilepiqgeaginippagflkealevckkenvlfvadeiqtglgrtgkvfacdwd
nvtpdmyilgkalgggvfpiscaaanrdilgvfepgshgstfggnplacavsiaalevle
eeklterslqlgeklvgqlkeidnpmitevrgkglfigielneparpyceqlkaagllck
ethenviriapplviseedlewafqkikavls

SCOPe Domain Coordinates for d3ruyb_:

Click to download the PDB-style file with coordinates for d3ruyb_.
(The format of our PDB-style files is described here.)

Timeline for d3ruyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ruya_