Lineage for d3ruya_ (3ruy A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896774Species Bacillus anthracis [TaxId:261594] [189194] (4 PDB entries)
  8. 2896779Domain d3ruya_: 3ruy A: [185193]
    automated match to d1gbna_

Details for d3ruya_

PDB Entry: 3ruy (more details), 2.65 Å

PDB Description: Crystal Structure of the Ornithine-oxo acid transaminase RocD from Bacillus anthracis
PDB Compounds: (A:) ornithine aminotransferase

SCOPe Domain Sequences for d3ruya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ruya_ c.67.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}
kdiieltdtygannyhplpiviskaegvwvedpegnrymdllsaysavnqghrhpkiina
lidqanrvtltsrafhsdqlgpwyekvakltnkemvlpmntgaeavetaiktarrwaydv
kkveanraeiivcednfhgrtmgavsmssneeykrgfgpmlpgiivipygdlealkaait
pntaafilepiqgeaginippagflkealevckkenvlfvadeiqtglgrtgkvfacdwd
nvtpdmyilgkalgggvfpiscaaanrdilgvfepgshgstfggnplacavsiaalevle
eeklterslqlgeklvgqlkeidnpmitevrgkglfigielneparpyceqlkaagllck
ethenviriapplviseedlewafqkikavls

SCOPe Domain Coordinates for d3ruya_:

Click to download the PDB-style file with coordinates for d3ruya_.
(The format of our PDB-style files is described here.)

Timeline for d3ruya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ruyb_