| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
| Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
| Protein Bile acid receptor FXR [101433] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101434] (8 PDB entries) |
| Domain d3ruua_: 3ruu A: [185192] automated match to d1osha_ complexed with 37g, so4 |
PDB Entry: 3ruu (more details), 2.5 Å
SCOPe Domain Sequences for d3ruua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ruua_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq
Timeline for d3ruua_: