Lineage for d3ruob_ (3ruo B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795288Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)
  6. 1795293Protein 3C cysteine protease (picornain 3C) [50604] (9 species)
  7. 1795316Species Human enterovirus b [TaxId:138949] [189732] (3 PDB entries)
  8. 1795320Domain d3ruob_: 3ruo B: [185191]
    automated match to d1l1na_
    protein/RNA complex; complexed with ag7, cl, mg

Details for d3ruob_

PDB Entry: 3ruo (more details), 1.5 Å

PDB Description: Complex structure of HevB EV93 main protease 3C with Rupintrivir (AG7088)
PDB Compounds: (B:) HEVB EV93 3C protease

SCOPe Domain Sequences for d3ruob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ruob_ b.47.1.4 (B:) 3C cysteine protease (picornain 3C) {Human enterovirus b [TaxId: 138949]}
kgpafefavammkrnastvkteygeftmlgiydrwavlprhakpgptilmndqevgvlda
kelvdkdgtnleltllklnrnekfrdirgflareevevneavlaintskfpnmyipvgqv
tdygflnlggtptkrmlvynfptragqcggvlmstgkvlgihvggnghqgfsaallrhyf
n

SCOPe Domain Coordinates for d3ruob_:

Click to download the PDB-style file with coordinates for d3ruob_.
(The format of our PDB-style files is described here.)

Timeline for d3ruob_: