Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins) |
Protein 3C cysteine protease (picornain 3C) [50604] (9 species) |
Species Human enterovirus b [TaxId:138949] [189732] (3 PDB entries) |
Domain d3ruoa_: 3ruo A: [185190] automated match to d1l1na_ protein/RNA complex; complexed with ag7, cl, mg |
PDB Entry: 3ruo (more details), 1.5 Å
SCOPe Domain Sequences for d3ruoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ruoa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human enterovirus b [TaxId: 138949]} mkgpafefavammkrnastvkteygeftmlgiydrwavlprhakpgptilmndqevgvld akelvdkdgtnleltllklnrnekfrdirgflareevevneavlaintskfpnmyipvgq vtdygflnlggtptkrmlvynfptragqcggvlmstgkvlgihvggnghqgfsaallrhy fnee
Timeline for d3ruoa_: