SCOPe 2.05: Domain d3ruoa_: 3ruo A:

Lineage for d3ruoa_ (3ruo A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein 3C cysteine protease (picornain 3C) [50604] (9 species)

7. Species Human enterovirus b [TaxId:138949] [189732] (3 PDB entries)

8. Domain d3ruoa_: 3ruo A: [185190]
   automated match to d1l1na_
   protein/RNA complex; complexed with ag7, cl, mg

Details for d3ruoa_

PDB Entry: 3ruo, 1.5 Å

PDB Description: Complex structure of HevB EV93 main protease 3C with Rupintrivir (AG7088)

PDB Compounds: (A:) HEVB EV93 3C protease

SCOPe Domain Sequences for d3ruoa_:

Sequence; same for both SEQRES and ATOM records:

>d3ruoa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human enterovirus b [TaxId: 138949]}
mkgpafefavammkrnastvkteygeftmlgiydrwavlprhakpgptilmndqevgvld
akelvdkdgtnleltllklnrnekfrdirgflareevevneavlaintskfpnmyipvgq
vtdygflnlggtptkrmlvynfptragqcggvlmstgkvlgihvggnghqgfsaallrhy
fnee

Timeline for d3ruoa_:

• d3ruoa_ first appeared in SCOPe 2.01
  
• d3ruoa_ appears in SCOPe 2.04
  
• d3ruoa_ is called d3ruoa1 in SCOPe 2.06
  
• d3ruoa_ appears in the current release, SCOPe 2.08, called d3ruoa1