Lineage for d1foee1 (1foe E:1035-1239)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719559Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2719560Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2719561Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 2719583Protein GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) [48073] (1 species)
  7. 2719584Species Mouse (Mus musculus) [TaxId:10090] [48074] (1 PDB entry)
  8. 2719587Domain d1foee1: 1foe E:1035-1239 [18519]
    Other proteins in same PDB: d1foea2, d1foeb_, d1foec2, d1foed_, d1foee2, d1foef_, d1foeg2, d1foeh_
    complexed with so4

Details for d1foee1

PDB Entry: 1foe (more details), 2.8 Å

PDB Description: crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1
PDB Compounds: (E:) t-lymphoma invasion and metastasis inducing protein 1

SCOPe Domain Sequences for d1foee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1foee1 a.87.1.1 (E:1035-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]}
lsdadklrkvicelletertyvkdlnclmerylkplqketfltqdeldvlfgnltemvef
qveflktledgvrlvpdleklekvdqfkkvlfslggsflyyadrfklysafcashtkvpk
vlvkaktdtafkafldaqnprqqhsstlesylikpiqrvlkyplllrelfaltdaeseeh
yhldvaiktmnkvashinemqkihe

SCOPe Domain Coordinates for d1foee1:

Click to download the PDB-style file with coordinates for d1foee1.
(The format of our PDB-style files is described here.)

Timeline for d1foee1: