Lineage for d1foea1 (1foe A:1034-1239)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.87: DBL homology domain [48064] (1 superfamily) Superfamily a.87.1: DBL homology domain [48065] (1 family) 
Family a.87.1.1: DBL homology domain [48066] (4 proteins) 
Protein GEF of TIAM1 (T-Lymphoma invasion and metastasis indusing protein 1) [48073] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [48074] (1 PDB entry) 
Domain d1foea1: 1foe A:1034-1239 [18517]
Other proteins in same PDB: d1foea2, d1foeb_, d1foec2, d1foed_, d1foee2, d1foef_, d1foeg2, d1foeh_
Details for d1foea1
PDB Entry: 1foe (more details), 2.8 Å
PDB Description: crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1
SCOP Domain Sequences for d1foea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis indusing protein 1) {Mouse (Mus musculus)}
qlsdadklrkvicelletertyvkdlnclmerylkplqketfltqdeldvlfgnltemve
fqveflktledgvrlvpdleklekvdqfkkvlfslggsflyyadrfklysafcashtkvp
kvlvkaktdtafkafldaqnprqqhsstlesylikpiqrvlkyplllrelfaltdaesee
hyhldvaiktmnkvashinemqkihe
SCOP Domain Coordinates for d1foea1:
Click to download the PDB-style file with coordinates for d1foea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1foea1:
View in 3D
