SCOPe 2.08: Domain d3ru8x1: 3ru8 X:1-274

Lineage for d3ru8x1 (3ru8 X:1-274)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families)

5. Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins)
   Pfam PF01341

6. Protein automated matches [191253] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189788] (1 PDB entry)

8. Domain d3ru8x1: 3ru8 X:1-274 [185162]
   Other proteins in same PDB: d3ru8x2
   automated match to d1tmla_
   complexed with gol

Details for d3ru8x1

PDB Entry: 3ru8, 2.07 Å

PDB Description: structure of an hiv epitope scaffold in complex with neutralizing antibody b12 fab

PDB Compounds: (X:) Epitope Scaffold 2bodx43

SCOPe Domain Sequences for d3ru8x1:

Sequence; same for both SEQRES and ATOM records:

>d3ru8x1 c.6.1.1 (X:1-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dspfyvnpnmssaewvrnnpndprtpvirnriasvpqgtwhnqhnpgqitgqvdalmsaa
qaagkipilvvdvgptgdmsqgeeagkqwidefaaglknrpayiivyplysggdpeivqe
wlrtvayagkalkagssqariyfdaghsawhspaqmaaalqradisnsahgiatntsnyr
wtadevayakavlsaignpslravidtsrngngpagnescdpsgraigtpsttntgdpmi
daflwiklpgeadgciagagqfvpqaayemaiaa

Timeline for d3ru8x1:

• d3ru8x1 first appeared in SCOPe 2.01, called d3ru8x_
  
• d3ru8x1 appears in SCOPe 2.07