Lineage for d3ru8x1 (3ru8 X:1-274)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850483Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2850484Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins)
    Pfam PF01341
  6. 2850528Protein automated matches [191253] (6 species)
    not a true protein
  7. 2850534Species Human (Homo sapiens) [TaxId:9606] [189788] (1 PDB entry)
  8. 2850535Domain d3ru8x1: 3ru8 X:1-274 [185162]
    Other proteins in same PDB: d3ru8x2
    automated match to d1tmla_
    complexed with gol

Details for d3ru8x1

PDB Entry: 3ru8 (more details), 2.07 Å

PDB Description: structure of an hiv epitope scaffold in complex with neutralizing antibody b12 fab
PDB Compounds: (X:) Epitope Scaffold 2bodx43

SCOPe Domain Sequences for d3ru8x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ru8x1 c.6.1.1 (X:1-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dspfyvnpnmssaewvrnnpndprtpvirnriasvpqgtwhnqhnpgqitgqvdalmsaa
qaagkipilvvdvgptgdmsqgeeagkqwidefaaglknrpayiivyplysggdpeivqe
wlrtvayagkalkagssqariyfdaghsawhspaqmaaalqradisnsahgiatntsnyr
wtadevayakavlsaignpslravidtsrngngpagnescdpsgraigtpsttntgdpmi
daflwiklpgeadgciagagqfvpqaayemaiaa

SCOPe Domain Coordinates for d3ru8x1:

Click to download the PDB-style file with coordinates for d3ru8x1.
(The format of our PDB-style files is described here.)

Timeline for d3ru8x1: