Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) |
Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins) Family 2 zinc amidase; |
Protein automated matches [190549] (4 species) not a true protein |
Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (40 PDB entries) |
Domain d3rt4b_: 3rt4 B: [185151] automated match to d1ycka1 complexed with lp5, tla |
PDB Entry: 3rt4 (more details), 1.7 Å
SCOPe Domain Sequences for d3rt4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rt4b_ d.118.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
Timeline for d3rt4b_: