Lineage for d1dbha1 (1dbh A:198-404)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540906Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 540907Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (1 family) (S)
  5. 540908Family a.87.1.1: DBL homology domain (DH-domain) [48066] (9 proteins)
    Pfam 00621
  6. 540950Protein Son of sevenless-1 (sos-1) [48067] (1 species)
  7. 540951Species Human (Homo sapiens) [TaxId:9606] [48068] (3 PDB entries)
  8. 540952Domain d1dbha1: 1dbh A:198-404 [18514]
    Other proteins in same PDB: d1dbha2

Details for d1dbha1

PDB Entry: 1dbh (more details), 2.3 Å

PDB Description: dbl and pleckstrin homology domains from hsos1

SCOP Domain Sequences for d1dbha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens)}
eqtyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsv
kllghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlsk
pgaalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqai
tallnvqsgmekicskslakrrlsesa

SCOP Domain Coordinates for d1dbha1:

Click to download the PDB-style file with coordinates for d1dbha1.
(The format of our PDB-style files is described here.)

Timeline for d1dbha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dbha2