Lineage for d1dbha1 (1dbh A:198-404)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5142Fold a.87: DBL homology domain [48064] (1 superfamily)
  4. 5143Superfamily a.87.1: DBL homology domain [48065] (1 family) (S)
  5. 5144Family a.87.1.1: DBL homology domain [48066] (4 proteins)
  6. 5157Protein Son of sevenless-1 (sos-1) [48067] (1 species)
  7. 5158Species Human (Homo sapiens) [TaxId:9606] [48068] (1 PDB entry)
  8. 5159Domain d1dbha1: 1dbh A:198-404 [18514]
    Other proteins in same PDB: d1dbha2

Details for d1dbha1

PDB Entry: 1dbh (more details), 2.3 Å

PDB Description: dbl and pleckstrin homology domains from hsos1

SCOP Domain Sequences for d1dbha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens)}
eqtyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsv
kllghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlsk
pgaalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqai
tallnvqsgmekicskslakrrlsesa

SCOP Domain Coordinates for d1dbha1:

Click to download the PDB-style file with coordinates for d1dbha1.
(The format of our PDB-style files is described here.)

Timeline for d1dbha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dbha2