Lineage for d1dbha1 (1dbh A:198-404)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719559Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2719560Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2719561Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 2719615Protein Son of sevenless-1 (sos-1) [48067] (1 species)
  7. 2719616Species Human (Homo sapiens) [TaxId:9606] [48068] (3 PDB entries)
    Uniprot Q07889 189-1046
  8. 2719617Domain d1dbha1: 1dbh A:198-404 [18514]
    Other proteins in same PDB: d1dbha2

Details for d1dbha1

PDB Entry: 1dbh (more details), 2.3 Å

PDB Description: dbl and pleckstrin homology domains from hsos1
PDB Compounds: (A:) protein (human sos 1)

SCOPe Domain Sequences for d1dbha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
eqtyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsv
kllghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlsk
pgaalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqai
tallnvqsgmekicskslakrrlsesa

SCOPe Domain Coordinates for d1dbha1:

Click to download the PDB-style file with coordinates for d1dbha1.
(The format of our PDB-style files is described here.)

Timeline for d1dbha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dbha2