Lineage for d3rrmc_ (3rrm C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326994Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1327532Superfamily b.69.14: Nucleoporin domain [117289] (1 family) (S)
  5. 1327533Family b.69.14.1: Nucleoporin domain [117290] (3 proteins)
  6. 1327540Protein automated matches [191295] (1 species)
    not a true protein
  7. 1327541Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189963] (1 PDB entry)
  8. 1327542Domain d3rrmc_: 3rrm C: [185131]
    Other proteins in same PDB: d3rrma1, d3rrma2
    automated match to d1xipa_
    complexed with adp, ihp, mg

Details for d3rrmc_

PDB Entry: 3rrm (more details), 2.9 Å

PDB Description: s. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp
PDB Compounds: (C:) Nucleoporin NUP159

SCOPe Domain Sequences for d3rrmc_:

Sequence, based on SEQRES records: (download)

>d3rrmc_ b.69.14.1 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gasslkdevptetsedfgfkflgqkqilpsfneklpfaslqnldisnskslfvaasgska
vvgelqllrdhitsdstpltfkwekeipdvifvcfhgdqvlvstrnalysldleelsefr
tvtsfekpvfqlknvnntlvilnsvndlsaldlrtkstkqlaqnvtsfdvtnsqlavllk
drsfqsfawrngemekqfefslpseleelpveeysplsvtilspqdflavfgnvisetdd
evsydqkmyiikhidgsasfqetfditppfgqivrfpymykvtlsgliepdanvnvlass
cssevsiwdskqviepsqdseravlpiseetdkdtnpigvavdvvtsgtilepcsgvdti
erlplvyilnnegslqivglfh

Sequence, based on observed residues (ATOM records): (download)

>d3rrmc_ b.69.14.1 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gasslkdevptetsedfgfkflgqkqilpsfneklpfaslqnldisnskslfvaasgska
vvgelqllrdhitsdstpltfkwekeipdvifvcfhgdqvlvstrnalysldleelsefr
tvtsfekpvfqlknvnntlvilnsvndlsaldlrtkstkqlaqnvtsfdvtnsqlavllk
drsfqsfawrngemekqfefslpseleelpveeysplsvtilspqdflavfgnvisetdd
evsydqkmyiikhidgsasfqetfditppfgqivrfpymykvtlsgliepdanvnvlass
cssevsiwdskqviepsqdseravlpiseetdkdtnpigvavdvvtsgtrlplvyilnne
gslqivglfh

SCOPe Domain Coordinates for d3rrmc_:

Click to download the PDB-style file with coordinates for d3rrmc_.
(The format of our PDB-style files is described here.)

Timeline for d3rrmc_: