Lineage for d3rrmc1 (3rrm C:2-381)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066522Superfamily b.69.14: Nucleoporin domain [117289] (1 family) (S)
  5. 2066523Family b.69.14.1: Nucleoporin domain [117290] (2 protein domains)
  6. 2066527Protein Nucleoporin NUP159 [117293] (1 species)
  7. 2066528Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117294] (3 PDB entries)
    Uniprot P40477 2-381
  8. 2066530Domain d3rrmc1: 3rrm C:2-381 [185131]
    Other proteins in same PDB: d3rrma1, d3rrma2, d3rrmc2
    automated match to d1xipa_
    complexed with adp, ihp, mg

Details for d3rrmc1

PDB Entry: 3rrm (more details), 2.9 Å

PDB Description: s. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp
PDB Compounds: (C:) Nucleoporin NUP159

SCOPe Domain Sequences for d3rrmc1:

Sequence, based on SEQRES records: (download)

>d3rrmc1 b.69.14.1 (C:2-381) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslkdevptetsedfgfkflgqkqilpsfneklpfaslqnldisnskslfvaasgskavv
gelqllrdhitsdstpltfkwekeipdvifvcfhgdqvlvstrnalysldleelsefrtv
tsfekpvfqlknvnntlvilnsvndlsaldlrtkstkqlaqnvtsfdvtnsqlavllkdr
sfqsfawrngemekqfefslpseleelpveeysplsvtilspqdflavfgnvisetddev
sydqkmyiikhidgsasfqetfditppfgqivrfpymykvtlsgliepdanvnvlasscs
sevsiwdskqviepsqdseravlpiseetdkdtnpigvavdvvtsgtilepcsgvdtier
lplvyilnnegslqivglfh

Sequence, based on observed residues (ATOM records): (download)

>d3rrmc1 b.69.14.1 (C:2-381) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslkdevptetsedfgfkflgqkqilpsfneklpfaslqnldisnskslfvaasgskavv
gelqllrdhitsdstpltfkwekeipdvifvcfhgdqvlvstrnalysldleelsefrtv
tsfekpvfqlknvnntlvilnsvndlsaldlrtkstkqlaqnvtsfdvtnsqlavllkdr
sfqsfawrngemekqfefslpseleelpveeysplsvtilspqdflavfgnvisetddev
sydqkmyiikhidgsasfqetfditppfgqivrfpymykvtlsgliepdanvnvlasscs
sevsiwdskqviepsqdseravlpiseetdkdtnpigvavdvvtsgtrlplvyilnnegs
lqivglfh

SCOPe Domain Coordinates for d3rrmc1:

Click to download the PDB-style file with coordinates for d3rrmc1.
(The format of our PDB-style files is described here.)

Timeline for d3rrmc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rrmc2