Lineage for d1bt2b_ (1bt2 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002034Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2002035Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2002059Family a.86.1.2: Catechol oxidase [48061] (2 protein domains)
  6. 2002060Protein Catechol oxidase [48062] (1 species)
  7. 2002061Species Sweet potato (Ipomoea batatas) [TaxId:4120] [48063] (4 PDB entries)
  8. 2002068Domain d1bt2b_: 1bt2 B: [18513]
    complexed with c2o

Details for d1bt2b_

PDB Entry: 1bt2 (more details), 2.7 Å

PDB Description: catechol oxidase from ipomoea batatas (sweet potatoes) in the reduced cu(i)-cu(i) state
PDB Compounds: (B:) protein (catechol oxidase)

SCOPe Domain Sequences for d1bt2b_:

Sequence, based on SEQRES records: (download)

>d1bt2b_ a.86.1.2 (B:) Catechol oxidase {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
apiqapeiskcvvppadlppgavvdnccppvasnivdyklpavttmkvrpaahtmdkdai
akfakavelmkalpaddprnfyqqalvhcaycnggydqvnfpdqeiqvhnswlffpfhrw
ylyfyerilgkligdpsfglpfwnwdnpggmvlpdflndstsslydsnrnqshlppvvvd
lgyngadtdvtdqqritdnlalmykqmvtnagtaelflgkayragdapspgagsietsph
ipihrwvgdprntnnedmgnfysagrdiafychhsnvdrmwtiwqqlagkprkrdytdsd
wlnatflfydengqavkvrigdsldnqkmgykyaktplpwl

Sequence, based on observed residues (ATOM records): (download)

>d1bt2b_ a.86.1.2 (B:) Catechol oxidase {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
apiqapeiskcvvppadlppgavvdnccppvasnivdyklpavttmkvrpaahtmdkdai
akfakavelmkalpaddprnfyqqalvhcaycnggydqvnfpdqeiqvhnswlffpfhrw
ylyfyerilgkligdpsfglpfwnwdnpggmvlpdflndstsslydsnrnqshlppvvvd
lgyngadtdvtdqqritdnlalmykqmvtnagtaelflgkayragdapspgagsietsph
ipihrwvgdprntnnedmgnfysagrdiafychhsnvdrmwtiwqqlardytdsdwlnat
flfydengqavkvrigdsldnqkmgykyaktplpwl

SCOPe Domain Coordinates for d1bt2b_:

Click to download the PDB-style file with coordinates for d1bt2b_.
(The format of our PDB-style files is described here.)

Timeline for d1bt2b_: