Lineage for d3rrca1 (3rrc A:211-508)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016272Fold a.264: Duffy binding domain-like [140923] (1 superfamily)
    consist of two subdomains, each containing a three-helical bundle
  4. 2016273Superfamily a.264.1: Duffy binding domain-like [140924] (2 families) (S)
    automatically mapped to Pfam PF05424
  5. 2016274Family a.264.1.1: Duffy binding domain [140925] (3 protein domains)
    Pfam PF05424
  6. 2016286Protein automated matches [191262] (2 species)
    not a true protein
  7. 2016287Species Plasmodium vivax [TaxId:126793] [189825] (4 PDB entries)
  8. 2016288Domain d3rrca1: 3rrc A:211-508 [185128]
    Other proteins in same PDB: d3rrca2, d3rrcb2
    automated match to d2c6ja1
    complexed with edo, po4

Details for d3rrca1

PDB Entry: 3rrc (more details), 1.95 Å

PDB Description: crystal structure of region ii from plasmodium vivax duffy binding protein
PDB Compounds: (A:) Duffy receptor

SCOPe Domain Sequences for d3rrca1:

Sequence, based on SEQRES records: (download)

>d3rrca1 a.264.1.1 (A:211-508) automated matches {Plasmodium vivax [TaxId: 126793]}
ntvmkncnykrkrrerdwdcntkkdvcipdrryqlcmkeltnlvnntdtnfhrditfrkl
ylkrkliydaavegdlllklnnyrynkdfckdirwslgdfgdiimgtdmegigyskvven
nlrsifgtdekaqqrrkqwwneskaqiwtammysvkkrlkgnfiwicklnvavniepqiy
rwirewgrdyvselptevqklkekcdgkinytdkkvckvppcqnacksydqwitrkknqw
dvlsnkfisvknaekvqtagivtpydilkqeldefnevafeneinkrdgayielcvcs

Sequence, based on observed residues (ATOM records): (download)

>d3rrca1 a.264.1.1 (A:211-508) automated matches {Plasmodium vivax [TaxId: 126793]}
ntvmkncnykrkrrerdwdcntkkdvcipdrryqlcmkeltnltfrklylkrkliydaav
egdlllklnnyrynkdfckdirwslgdfgdiimgtdmegigyskvvennlrsifgtdeka
qqrrkqwwneskaqiwtammysvcklnvavniepqiyrwirewgrdyvselptevqklke
kcdgkinytdkkvckvppcqnacksydqwitrkknqwdvlsnkfisvknaekvqtagivt
pydilkqeldefnevafeneinkrdgayielcvcs

SCOPe Domain Coordinates for d3rrca1:

Click to download the PDB-style file with coordinates for d3rrca1.
(The format of our PDB-style files is described here.)

Timeline for d3rrca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rrca2