Lineage for d3rptx1 (3rpt X:2-274)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097504Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2097505Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2097506Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 protein domains)
    Pfam PF01341
  6. 2097550Protein automated matches [191253] (7 species)
    not a true protein
  7. 2097561Species Thermobifida fusca [TaxId:2021] [190013] (1 PDB entry)
  8. 2097563Domain d3rptx1: 3rpt X:2-274 [185098]
    Other proteins in same PDB: d3rpta2, d3rptx2
    automated match to d1tmla_
    complexed with so4

Details for d3rptx1

PDB Entry: 3rpt (more details), 1.3 Å

PDB Description: crystal structure of the anti-hiv b12 scaffold protein
PDB Compounds: (X:) endoglucanase e-2

SCOPe Domain Sequences for d3rptx1:

Sequence, based on SEQRES records: (download)

>d3rptx1 c.6.1.1 (X:2-274) automated matches {Thermobifida fusca [TaxId: 2021]}
spfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwhnqhnpgqitgqvdalmsaaq
aagkipilvvnpdpggdmdngfeegkqwidefaaglknrpayiivdpggsggdpeiaeaa
wrfaayagkalkagssqariyfdaghsawhspaqmaaalqradisnsahgiatntsnyrw
tadevayakavlsaignpslravidtsrngngpagnescdpsgraigtpsttntgdpmid
aflwiklpgeadgciagagqfvpqaayemaiaa

Sequence, based on observed residues (ATOM records): (download)

>d3rptx1 c.6.1.1 (X:2-274) automated matches {Thermobifida fusca [TaxId: 2021]}
spfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwhnqgqitgqvdalmsaaqaag
kipilvvnpdfeegkqwidefaaglknrpayiivdpaawrfaayagkalkagssqariyf
daghsawhspaqmaaalqradisnsahgiatntsnyrwtadevayakavlsaignpslra
vidtsrngngpagnescdpsgraigtpsttntgdpmidaflwiklpgeadgciagagqfv
pqaayemaiaa

SCOPe Domain Coordinates for d3rptx1:

Click to download the PDB-style file with coordinates for d3rptx1.
(The format of our PDB-style files is described here.)

Timeline for d3rptx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rptx2