Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.13: DsbA-like [100953] (4 proteins) contains an all-alpha subdomain insertion |
Protein automated matches [190208] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188162] (3 PDB entries) |
Domain d3rpnd_: 3rpn D: [185092] automated match to d1r4wa_ complexed with gtx |
PDB Entry: 3rpn (more details), 1.9 Å
SCOPe Domain Sequences for d3rpnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rpnd_ c.47.1.13 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gplprtvelfydvlspyswlgfeilcryqniwninlqlrpslitgimkdsgnkppgllpr kglymandlkllrhhlqipihfpkdflsvmlekgslsamrfltavnlehpemlekasrel wmrvwsrneditepqsilaaaekagmsaeqaqgllekiatpkvknqlketteaacrygaf glpitvahvdgqthmlfgsdrmellahllgekwmgpippa
Timeline for d3rpnd_: