SCOPe 2.06: Domain d3romb1: 3rom B:45-296

Lineage for d3romb1 (3rom B:45-296)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
   contains extra N-terminal all-alpha subdomain
   automatically mapped to Pfam PF02267

6. Protein ADP ribosyl cyclase [56631] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159490] (42 PDB entries)
   Uniprot P28907 45-291

8. Domain d3romb1: 3rom B:45-296 [185086]
   Other proteins in same PDB: d3romb2
   automated match to d2ef1a1
   complexed with 48z

Details for d3romb1

PDB Entry: 3rom, 2.04 Å

PDB Description: crystal structure of human cd38 in complex with compound cz-48

PDB Compounds: (B:) ADP-ribosyl cyclase 1

SCOPe Domain Sequences for d3romb1:

Sequence; same for both SEQRES and ATOM records:

>d3romb1 c.23.14.3 (B:45-296) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditee
dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefd
tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgs
vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf
lqcvknpedssc

Timeline for d3romb1:

• d3romb1 first appeared in SCOPe 2.01, called d3romb_
  
• d3romb1 was called d3romb_ in SCOPe 2.05
  
• d3romb1 appears in SCOPe 2.07
  
• d3romb1 appears in the current release, SCOPe 2.08