![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) ![]() there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
![]() | Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins) contains extra N-terminal all-alpha subdomain automatically mapped to Pfam PF02267 |
![]() | Protein ADP ribosyl cyclase [56631] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [159490] (45 PDB entries) Uniprot P28907 45-291 |
![]() | Domain d3rokb_: 3rok B: [185084] automated match to d2ef1a1 complexed with 27c |
PDB Entry: 3rok (more details), 1.65 Å
SCOPe Domain Sequences for d3rokb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rokb_ c.23.14.3 (B:) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]} rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditee dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefd tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgs vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf lqcvknpedssc
Timeline for d3rokb_: