![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) ![]() |
![]() | Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins) |
![]() | Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species) |
![]() | Species Bacillus amyloliquefaciens [TaxId:1390] [53186] (3 PDB entries) |
![]() | Domain d3ro0b_: 3ro0 B: [185075] automated match to d1auga_ complexed with tpt |
PDB Entry: 3ro0 (more details), 1.5 Å
SCOPe Domain Sequences for d3ro0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ro0b_ c.56.4.1 (B:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Bacillus amyloliquefaciens [TaxId: 1390]} mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreamkk hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks apslsldhitkalkiaavtaaaheddiet
Timeline for d3ro0b_: