Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) |
Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins) |
Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species) |
Species Bacillus amyloliquefaciens [TaxId:1390] [53186] (3 PDB entries) |
Domain d3rnzc_: 3rnz C: [185072] automated match to d1auga_ |
PDB Entry: 3rnz (more details), 2.01 Å
SCOPe Domain Sequences for d3rnzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rnzc_ c.56.4.1 (C:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Bacillus amyloliquefaciens [TaxId: 1390]} ekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreamkkh qpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpikr iveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqksa pslsldhitkalkiaavtaaaheddi
Timeline for d3rnzc_: