Lineage for d3rnzb_ (3rnz B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889399Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 2889400Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins)
    automatically mapped to Pfam PF01470
  6. 2889401Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species)
  7. 2889402Species Bacillus amyloliquefaciens [TaxId:1390] [53186] (3 PDB entries)
  8. 2889412Domain d3rnzb_: 3rnz B: [185071]
    automated match to d1auga_

Details for d3rnzb_

PDB Entry: 3rnz (more details), 2.01 Å

PDB Description: crystal structure of bacillus amyloliquefaciens pyroglutamyl peptidase i
PDB Compounds: (B:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d3rnzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rnzb_ c.56.4.1 (B:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Bacillus amyloliquefaciens [TaxId: 1390]}
mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreamkk
hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik
riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks
apslsldhitkalkiaavtaaaheddiet

SCOPe Domain Coordinates for d3rnzb_:

Click to download the PDB-style file with coordinates for d3rnzb_.
(The format of our PDB-style files is described here.)

Timeline for d3rnzb_: