Lineage for d1bt3a_ (1bt3 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002034Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2002035Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2002059Family a.86.1.2: Catechol oxidase [48061] (2 protein domains)
  6. 2002060Protein Catechol oxidase [48062] (1 species)
  7. 2002061Species Sweet potato (Ipomoea batatas) [TaxId:4120] [48063] (4 PDB entries)
  8. 2002062Domain d1bt3a_: 1bt3 A: [18507]
    complexed with c2o

Details for d1bt3a_

PDB Entry: 1bt3 (more details), 2.5 Å

PDB Description: catechol oxidase from ipomoea batatas (sweet potatoes) in the native cu(ii)-cu(ii) state
PDB Compounds: (A:) protein (catechol oxidase)

SCOPe Domain Sequences for d1bt3a_:

Sequence, based on SEQRES records: (download)

>d1bt3a_ a.86.1.2 (A:) Catechol oxidase {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
apiqapeiskcvvppadlppgavvdnccppvasnivdyklpavttmkvrpaahtmdkdai
akfakavelmkalpaddprnfyqqalvhcaycnggydqvnfpdqeiqvhnswlffpfhrw
ylyfyerilgkligdpsfglpfwnwdnpggmvlpdflndstsslydsnrnqshlppvvvd
lgyngadtdvtdqqritdnlalmykqmvtnagtaelflgkayragdapspgagsietsph
ipihrwvgdprntnnedmgnfysagrdiafychhsnvdrmwtiwqqlagkprkrdytdsd
wlnatflfydengqavkvrigdsldnqkmgykyaktplpwl

Sequence, based on observed residues (ATOM records): (download)

>d1bt3a_ a.86.1.2 (A:) Catechol oxidase {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
apiqapeiskcvvppadlppgavvdnccppvasnivdyklpavttmkvrpaahtmdkdai
akfakavelmkalpaddprnfyqqalvhcaycnggydqvnfpdqeiqvhnswlffpfhrw
ylyfyerilgkligdpsfglpfwnwdnpggmvlpdflndstsslydsnrnqshlppvvvd
lgyngadtdvtdqqritdnlalmykqmvtnagtaelflgkayragdapspgagsietsph
ipihrwvgdprntnnedmgnfysagrdiafychhsnvdrmwtiwqqlardytdsdwlnat
flfydengqavkvrigdsldnqkmgykyaktplpwl

SCOPe Domain Coordinates for d1bt3a_:

Click to download the PDB-style file with coordinates for d1bt3a_.
(The format of our PDB-style files is described here.)

Timeline for d1bt3a_: