Lineage for d3rnmf1 (3rnm F:111-152)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697346Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 2697347Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 2697377Family a.9.1.0: automated matches [191674] (1 protein)
    not a true family
  6. 2697378Protein automated matches [191291] (5 species)
    not a true protein
  7. 2697389Species Human (Homo sapiens) [TaxId:9606] [189945] (2 PDB entries)
  8. 2697391Domain d3rnmf1: 3rnm F:111-152 [185065]
    Other proteins in same PDB: d3rnme2, d3rnmf2
    automated match to d1w3da_
    complexed with bme, fad, nhe

Details for d3rnmf1

PDB Entry: 3rnm (more details), 2.4 Å

PDB Description: The crystal structure of the subunit binding of human dihydrolipoamide transacylase (E2b) bound to human dihydrolipoamide dehydrogenase (E3)
PDB Compounds: (F:) Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial

SCOPe Domain Sequences for d3rnmf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rnmf1 a.9.1.0 (F:111-152) automated matches {Human (Homo sapiens) [TaxId: 9606]}
latpavrnlamenniklsevvgsgkdgrilkedilnylekqt

SCOPe Domain Coordinates for d3rnmf1:

Click to download the PDB-style file with coordinates for d3rnmf1.
(The format of our PDB-style files is described here.)

Timeline for d3rnmf1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rnmf2