| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily) 3 helices; bundle, closed, right-handed twist; up-and-down |
Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) ![]() |
| Family a.9.1.0: automated matches [191674] (1 protein) not a true family |
| Protein automated matches [191291] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189945] (2 PDB entries) |
| Domain d3rnmf1: 3rnm F:111-152 [185065] Other proteins in same PDB: d3rnme2, d3rnmf2 automated match to d1w3da_ complexed with bme, fad, nhe |
PDB Entry: 3rnm (more details), 2.4 Å
SCOPe Domain Sequences for d3rnmf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rnmf1 a.9.1.0 (F:111-152) automated matches {Human (Homo sapiens) [TaxId: 9606]}
latpavrnlamenniklsevvgsgkdgrilkedilnylekqt
Timeline for d3rnmf1: