Lineage for d3rnme_ (3rnm E:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
3 helices; bundle, closed, right-handed twist; up-and-downSuperfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) 
Family a.9.1.0: automated matches [191674] (1 protein)
not a true familyProtein automated matches [191291] (4 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [189945] (2 PDB entries) 
Domain d3rnme_: 3rnm E: [185064]
automated match to d1w3da_
complexed with bme, fad, nhe
Details for d3rnme_
PDB Entry: 3rnm (more details), 2.4 Å
PDB Description: The crystal structure of the subunit binding of human dihydrolipoamide transacylase (E2b) bound to human dihydrolipoamide dehydrogenase (E3)
PDB Compounds: (E:) Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrialSCOPe Domain Sequences for d3rnme_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rnme_ a.9.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlatpavrnlamenniklsevvgsgkdgrilkedilnylekqtlehhhhhh
SCOPe Domain Coordinates for d3rnme_:
Click to download the PDB-style file with coordinates for d3rnme_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3rnme_:
- d3rnme_ first appeared in SCOPe 2.01
- d3rnme_ appears in SCOPe 2.04
- d3rnme_ is called d3rnme1 in SCOPe 2.06
- d3rnme_ appears in the current release, SCOPe 2.08, called d3rnme1
View in 3D
