Lineage for d3rngb_ (3rng B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2316569Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2316847Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species)
  7. 2316848Species Pseudomonas sp. [TaxId:320855] [189498] (11 PDB entries)
  8. 2316855Domain d3rngb_: 3rng B: [185060]
    Other proteins in same PDB: d3rnga_, d3rngc_
    automated match to d1t0rb_
    complexed with fe, oh; mutant

Details for d3rngb_

PDB Entry: 3rng (more details), 2.81 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase T201S/W167E Double Mutant
PDB Compounds: (B:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3rngb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rngb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas sp. [TaxId: 320855]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmg

SCOPe Domain Coordinates for d3rngb_:

Click to download the PDB-style file with coordinates for d3rngb_.
(The format of our PDB-style files is described here.)

Timeline for d3rngb_: