Lineage for d1hcya2 (1hcy A:136-398)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719416Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2719417Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2719418Family a.86.1.1: Hemocyanin middle domain [48057] (2 proteins)
  6. 2719419Protein Arthropod hemocyanin [48058] (2 species)
    N-terminal domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 2719425Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48060] (2 PDB entries)
  8. 2719427Domain d1hcya2: 1hcy A:136-398 [18506]
    Other proteins in same PDB: d1hcya1, d1hcya3, d1hcyb1, d1hcyb3, d1hcyc1, d1hcyc3, d1hcyd1, d1hcyd3, d1hcye1, d1hcye3, d1hcyf1, d1hcyf3
    complexed with cu

Details for d1hcya2

PDB Entry: 1hcy (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution
PDB Compounds: (A:) arthropodan hemocyanin

SCOPe Domain Sequences for d1hcya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcya2 a.86.1.1 (A:136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
plyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqrvayfgedigmnihhv
twhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriireg
fapltsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidi
rqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetat
rdpsffrlhkymdnifkkhtdsf

SCOPe Domain Coordinates for d1hcya2:

Click to download the PDB-style file with coordinates for d1hcya2.
(The format of our PDB-style files is described here.)

Timeline for d1hcya2: