SCOPe 2.05: Domain d3rnfb_: 3rnf B:

Lineage for d3rnfb_ (3rnf B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species)

7. Species Pseudomonas sp. [TaxId:320855] [189498] (11 PDB entries)

8. Domain d3rnfb_: 3rnf B: [185057]
   Other proteins in same PDB: d3rnfa_, d3rnfc_
   automated match to d1t0rb_
   complexed with 1pe, edo, fe; mutant

Details for d3rnfb_

PDB Entry: 3rnf, 2.2 Å

PDB Description: structure of the toluene/o-xylene monooxygenase hydroxylase t201s/v271a double mutant

PDB Compounds: (B:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3rnfb_:

Sequence; same for both SEQRES and ATOM records:

>d3rnfb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas sp. [TaxId: 320855]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmgl

Timeline for d3rnfb_:

• d3rnfb_ first appeared in SCOPe 2.01
  
• d3rnfb_ appears in SCOPe 2.04
  
• d3rnfb_ appears in SCOPe 2.06
  
• d3rnfb_ appears in the current release, SCOPe 2.08