Lineage for d3rnfb_ (3rnf B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703588Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species)
  7. 2703589Species Pseudomonas sp. [TaxId:320855] [189498] (11 PDB entries)
  8. 2703600Domain d3rnfb_: 3rnf B: [185057]
    Other proteins in same PDB: d3rnfa_, d3rnfc_
    automated match to d1t0rb_
    complexed with 1pe, edo, fe; mutant

Details for d3rnfb_

PDB Entry: 3rnf (more details), 2.2 Å

PDB Description: structure of the toluene/o-xylene monooxygenase hydroxylase t201s/v271a double mutant
PDB Compounds: (B:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3rnfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rnfb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas sp. [TaxId: 320855]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmgl

SCOPe Domain Coordinates for d3rnfb_:

Click to download the PDB-style file with coordinates for d3rnfb_.
(The format of our PDB-style files is described here.)

Timeline for d3rnfb_: