SCOPe 2.05: Domain d3rn9c_: 3rn9 C:

Lineage for d3rn9c_ (3rn9 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.12: TmoB-like [110814] (2 families)
   possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.12.1: TmoB-like [110815] (1 protein)
   Pfam PF06234

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (2 species)

7. Species Pseudomonas sp. [TaxId:320855] [189499] (11 PDB entries)

8. Domain d3rn9c_: 3rn9 C: [185045]
   Other proteins in same PDB: d3rn9a_, d3rn9b_
   automated match to d1t0rc_
   complexed with 1pe, edo, fe, oh, so4; mutant

Details for d3rn9c_

PDB Entry: 3rn9, 2.8 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase T201S/L272E Double Mutant

PDB Compounds: (C:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3rn9c_:

Sequence; same for both SEQRES and ATOM records:

>d3rn9c_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas sp. [TaxId: 320855]}
tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
prgmivsdaglrptetldiifmdn

Timeline for d3rn9c_:

• d3rn9c_ first appeared in SCOPe 2.01
  
• d3rn9c_ appears in SCOPe 2.04
  
• d3rn9c_ appears in SCOPe 2.06
  
• d3rn9c_ appears in the current release, SCOPe 2.08