SCOPe 2.07: Domain d3rn9a_: 3rn9 A:

Lineage for d3rn9a_ (3rn9 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouA [109788] (2 species)
   contains the TouB(TmoB)-binding YHS (sub)domain (Pfam PF04945) in the C-terminal part (401-450)

7. Species Pseudomonas sp. [TaxId:320855] [189497] (11 PDB entries)

8. Domain d3rn9a_: 3rn9 A: [185043]
   Other proteins in same PDB: d3rn9b_, d3rn9c_
   automated match to d1t0qa_
   complexed with 1pe, edo, fe, oh, so4; mutant

Details for d3rn9a_

PDB Entry: 3rn9, 2.8 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase T201S/L272E Double Mutant

PDB Compounds: (A:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3rn9a_:

Sequence; same for both SEQRES and ATOM records:

>d3rn9a_ a.25.1.2 (A:) Toluene, o-xylene monooxygenase oxygenase subunit TouA {Pseudomonas sp. [TaxId: 320855]}
smlkredwydltrttnwtpkyvtenelfpeemsgargismeawekydepykitypeyvsi
qrekdsgaysikaalerdgfvdradpgwvstmqlhfgaialeeyaastaearmarfakap
gnrnmatfgmmdenrhgqiqlyfpyanvkrsrkwdwahkaihtnewaaiaarsffddmmm
trdsvavsimltfafetgfsnmqflglaadaaeagdhtfaslissiqtdesrhaqqggps
lkilvengkkdeaqqmvdvaiwrswklfsvetgpimdyytplesrnqsfkefmlewivaq
ferqlldlgldkpwywdqfmqdldethhgmhlgvwywrptvwwdpaagvspeerewleek
ypgwndtwgqcwdvitdnlvngkpeltvpetlpticnmcnlpiahtpgnkwnvkdyqley
egrlyhfgseadrwcfqidperyknhtnlvdrflkgeiqpadlagalmymslepgvmgdd
ahdyewvkayq

Timeline for d3rn9a_:

• d3rn9a_ first appeared in SCOPe 2.01
  
• d3rn9a_ appears in SCOPe 2.06
  
• d3rn9a_ appears in the current release, SCOPe 2.08