Lineage for d3rn8c_ (3rn8 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2521242Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2521243Species Human (Homo sapiens) [TaxId:9606] [189807] (4 PDB entries)
  8. 2521249Domain d3rn8c_: 3rn8 C: [185042]
    automated match to d1lb8a_
    complexed with act, glu, rn8, so4, zn

Details for d3rn8c_

PDB Entry: 3rn8 (more details), 1.7 Å

PDB Description: crystal structure of iglur2 ligand binding domain and symmetrical carboxyl containing potentiator
PDB Compounds: (C:) Glutamate receptor 2

SCOPe Domain Sequences for d3rn8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rn8c_ c.94.1.1 (C:) Glutamate receptor ligand binding core {Human (Homo sapiens) [TaxId: 9606]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

SCOPe Domain Coordinates for d3rn8c_:

Click to download the PDB-style file with coordinates for d3rn8c_.
(The format of our PDB-style files is described here.)

Timeline for d3rn8c_: