Lineage for d3rmze_ (3rmz E:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1704092Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1704093Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1704094Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 1704115Protein automated matches [190303] (3 species)
    not a true protein
  7. 1704147Species Paracoccus denitrificans [TaxId:318586] [189284] (19 PDB entries)
  8. 1704151Domain d3rmze_: 3rmz E: [185037]
    Other proteins in same PDB: d3rmzd_, d3rmzf_
    automated match to d1mg2b_
    complexed with act, ca, edo, hec, mes, na, p6g, peg, pg4

Details for d3rmze_

PDB Entry: 3rmz (more details), 1.72 Å

PDB Description: Crystal Structure of the W199F-MauG/pre-Methylamine Dehydrogenase Complex
PDB Compounds: (E:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3rmze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rmze_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgka

SCOPe Domain Coordinates for d3rmze_:

Click to download the PDB-style file with coordinates for d3rmze_.
(The format of our PDB-style files is described here.)

Timeline for d3rmze_: