SCOPe 2.01: Domain d3rmzc_: 3rmz C:

Lineage for d3rmzc_ (3rmz C:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)

6. Protein automated matches [190303] (2 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [189284] (9 PDB entries)

8. Domain d3rmzc_: 3rmz C: [185036]
   automated match to d1mg2b_
   complexed with act, ca, edo, hec, mes, na, p6g, peg, pg4

Details for d3rmzc_

PDB Entry: 3rmz, 1.72 Å

PDB Description: Crystal Structure of the W199F-MauG/pre-Methylamine Dehydrogenase Complex

PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3rmzc_:

Sequence; same for both SEQRES and ATOM records:

>d3rmzc_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkashhhhhh

Timeline for d3rmzc_:

• d3rmzc_ is new in SCOPe 2.01-stable
  
• d3rmzc_ appears in SCOPe 2.02
  
• d3rmzc_ appears in the current release, SCOPe 2.08, called d3rmzc1