Lineage for d3rlra_ (3rlr A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1429695Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1429696Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1429697Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 1429698Protein HSP90 [55876] (3 species)
  7. 1429775Species Human (Homo sapiens) [TaxId:9606] [55878] (69 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 1429794Domain d3rlra_: 3rlr A: [185028]
    automated match to d1osfa_
    complexed with 3rr, po4

Details for d3rlra_

PDB Entry: 3rlr (more details), 1.7 Å

PDB Description: Co-crystal structure of the HSP90 ATP binding domain in complex with 4-(2,4-dichloro-5-methoxyphenyl)-2,6-dimethyl-7H-pyrrolo[2,3-d]pyrimidine-5-carbonitrile
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3rlra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rlra_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadi
smigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvil
hlkedqteyleerrikeivkkhsqfigypitlfvekele

SCOPe Domain Coordinates for d3rlra_:

Click to download the PDB-style file with coordinates for d3rlra_.
(The format of our PDB-style files is described here.)

Timeline for d3rlra_: