Class g: Small proteins [56992] (94 folds) |
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) |
Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins) automatically mapped to Pfam PF02975 |
Protein automated matches [190303] (3 species) not a true protein |
Species Paracoccus denitrificans [TaxId:318586] [189284] (9 PDB entries) |
Domain d3rlme_: 3rlm E: [185023] Other proteins in same PDB: d3rlmc2, d3rlmd_, d3rlmf_ automated match to d1mg2b_ complexed with act, ca, hec, pge |
PDB Entry: 3rlm (more details), 2.13 Å
SCOPe Domain Sequences for d3rlme_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rlme_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 318586]} tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi vgkas
Timeline for d3rlme_:
View in 3D Domains from other chains: (mouse over for more information) d3rlmc1, d3rlmc2, d3rlmd_, d3rlmf_ |