Lineage for d3rlfg_ (3rlf G:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256584Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. 2256585Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. 2256586Family f.58.1.1: MetI-like [161099] (6 proteins)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. 2256620Protein automated matches [191243] (1 species)
    not a true protein
  7. 2256621Species Escherichia coli K-12 [TaxId:83333] [189709] (8 PDB entries)
  8. 2256622Domain d3rlfg_: 3rlf G: [185019]
    Other proteins in same PDB: d3rlfa1, d3rlfa2, d3rlfa3, d3rlfb1, d3rlfb2, d3rlfb3, d3rlfe1, d3rlfe2, d3rlff1, d3rlff2
    automated match to d2r6gg1
    complexed with anp, mal, mg, pgv, umq

Details for d3rlfg_

PDB Entry: 3rlf (more details), 2.2 Å

PDB Description: crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp
PDB Compounds: (G:) Maltose transport system permease protein malG

SCOPe Domain Sequences for d3rlfg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rlfg_ f.58.1.1 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
arlfithlllllfiaaimfpllmvvaislrqgnfatgslipeqiswdhwklalgfsveqa
dgritpppfpvllwlwnsvkvagisaigivalsttcayafarmrfpgkatllkgmlifqm
fpavlslvalyalfdrlgeyipfiglnthggvifaylggialhvwtikgyfetidsslee
aaaldgatpwqafrlvllplsvpilavvfilsfiaaitevpvaslllrdvnsytlavgmq
qylnpqnylwgdfaaaavmsalpitivfllaqrwlvngltaggvkg

SCOPe Domain Coordinates for d3rlfg_:

Click to download the PDB-style file with coordinates for d3rlfg_.
(The format of our PDB-style files is described here.)

Timeline for d3rlfg_: