Lineage for d3rl8e_ (3rl8 E:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948106Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 948107Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 948108Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 948399Protein automated matches [190055] (4 species)
    not a true protein
  7. 948403Species Human (Homo sapiens) [TaxId:9606] [187785] (13 PDB entries)
  8. 948425Domain d3rl8e_: 3rl8 E: [185016]
    automated match to d1qlca_

Details for d3rl8e_

PDB Entry: 3rl8 (more details), 2.2 Å

PDB Description: crystal structure of hdlg1-pdz2 complexed with apc
PDB Compounds: (E:) Disks large homolog 1

SCOPe Domain Sequences for d3rl8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rl8e_ b.36.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavn
nvcleevtheeavtalkntsdfvylkvakp

SCOPe Domain Coordinates for d3rl8e_:

Click to download the PDB-style file with coordinates for d3rl8e_.
(The format of our PDB-style files is described here.)

Timeline for d3rl8e_: