Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries) |
Domain d3rl8a_: 3rl8 A: [185012] automated match to d1qlca_ |
PDB Entry: 3rl8 (more details), 2.2 Å
SCOPe Domain Sequences for d3rl8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rl8a_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavn nvcleevtheeavtalkntsdfvylkvakptsmy
Timeline for d3rl8a_:
View in 3D Domains from other chains: (mouse over for more information) d3rl8b_, d3rl8c_, d3rl8d_, d3rl8e_ |