SCOPe 2.01: Domain d3rl7b_: 3rl7 B:

Lineage for d3rl7b_ (3rl7 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (13 PDB entries)

8. Domain d3rl7b_: 3rl7 B: [185007]
   automated match to d1zoka1

Details for d3rl7b_

PDB Entry: 3rl7, 2.3 Å

PDB Description: crystal structure of hdlg1-pdz1 complexed with apc

PDB Compounds: (B:) Disks large homolog 1

SCOPe Domain Sequences for d3rl7b_:

Sequence, based on SEQRES records:

>d3rl7b_ b.36.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
myeyeeitlergnsglgfsiaggtdnphigddssifitkiitggaaaqdgrlrvndcilr
vnevdvrdvthskavealkeagsivrlyvkrr

Sequence, based on observed residues (ATOM records):

>d3rl7b_ b.36.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
myeyeeitlergnsglgfsiaggtdnphdssifitkiitggaaaqdgrlrvndcilrvne
vdvrdvthskavealkeagsivrlyvkrr

Timeline for d3rl7b_:

• d3rl7b_ is new in SCOPe 2.01-stable
  
• d3rl7b_ appears in SCOPe 2.02
  
• d3rl7b_ appears in the current release, SCOPe 2.08, called d3rl7b1