SCOPe 2.04: Domain d3rk1b_: 3rk1 B:

Lineage for d3rk1b_ (3rk1 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein Putative N-type ATP pyrophosphatase PF0828 [102264] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [102265] (3 PDB entries)

8. Domain d3rk1b_: 3rk1 B: [185000]
   automated match to d1ru8a_
   complexed with atp, po4

Details for d3rk1b_

PDB Entry: 3rk1, 2.3 Å

PDB Description: 'X-ray crystal Structure of the putative N-type ATP pyrophosphatase (PF0828) in complex with ATP from Pyrococcus furiosus, Northeast Structural Genomics Consortium Target PfR23

PDB Compounds: (B:) N-type ATP pyrophosphatase superfamily

SCOPe Domain Sequences for d3rk1b_:

Sequence, based on SEQRES records:

>d3rk1b_ c.26.2.1 (B:) Putative N-type ATP pyrophosphatase PF0828 {Pyrococcus furiosus [TaxId: 2261]}
ladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqaralg
iplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevytpa
wgrdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvage
ggefetfvldmplfkykivvdkakkvwepctssgkliieeahleskl

Sequence, based on observed residues (ATOM records):

>d3rk1b_ c.26.2.1 (B:) Putative N-type ATP pyrophosphatase PF0828 {Pyrococcus furiosus [TaxId: 2261]}
ladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqaralg
iplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevytpd
akeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvageggef
etfvldmplfkykivvdkakkvwepctssgkliieeahleskl

Timeline for d3rk1b_:

• d3rk1b_ first appeared in SCOPe 2.01
  
• d3rk1b_ appears in SCOPe 2.03
  
• d3rk1b_ appears in SCOPe 2.05
  
• d3rk1b_ appears in the current release, SCOPe 2.08, called d3rk1b1