Lineage for d3rk1a_ (3rk1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861264Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2861379Protein Putative N-type ATP pyrophosphatase PF0828 [102264] (1 species)
  7. 2861380Species Pyrococcus furiosus [TaxId:2261] [102265] (5 PDB entries)
  8. 2861381Domain d3rk1a_: 3rk1 A: [184999]
    Other proteins in same PDB: d3rk1b2
    automated match to d1ru8a_
    complexed with atp, po4

    has additional subdomain(s) that are not in the common domain

Details for d3rk1a_

PDB Entry: 3rk1 (more details), 2.3 Å

PDB Description: 'X-ray crystal Structure of the putative N-type ATP pyrophosphatase (PF0828) in complex with ATP from Pyrococcus furiosus, Northeast Structural Genomics Consortium Target PfR23
PDB Compounds: (A:) N-type ATP pyrophosphatase superfamily

SCOPe Domain Sequences for d3rk1a_:

Sequence, based on SEQRES records: (download)

>d3rk1a_ c.26.2.1 (A:) Putative N-type ATP pyrophosphatase PF0828 {Pyrococcus furiosus [TaxId: 2261]}
advavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqaralgi
plvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevytpaw
grdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvageg
gefetfvldmplfkykivvdkakkvwepctssgkliieeahlesk

Sequence, based on observed residues (ATOM records): (download)

>d3rk1a_ c.26.2.1 (A:) Putative N-type ATP pyrophosphatase PF0828 {Pyrococcus furiosus [TaxId: 2261]}
advavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqaralgi
plvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevytpda
keymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvageggefe
tfvldmplfkykivvdkakkvwepctssgkliieeahlesk

SCOPe Domain Coordinates for d3rk1a_:

Click to download the PDB-style file with coordinates for d3rk1a_.
(The format of our PDB-style files is described here.)

Timeline for d3rk1a_: