SCOPe 2.01: Domain d3rjza_: 3rjz A:

Lineage for d3rjza_ (3rjz A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein Putative N-type ATP pyrophosphatase PF0828 [102264] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [102265] (3 PDB entries)

8. Domain d3rjza_: 3rjz A: [184997]
   automated match to d1ru8a_

Details for d3rjza_

PDB Entry: 3rjz, 2.3 Å

PDB Description: X-ray crystal structure of the putative n-type atp pyrophosphatase from pyrococcus furiosus, the northeast structural genomics target pfr23

PDB Compounds: (A:) N-type ATP pyrophosphatase superfamily

SCOPe Domain Sequences for d3rjza_:

Sequence, based on SEQRES records:

>d3rjza_ c.26.2.1 (A:) Putative N-type ATP pyrophosphatase PF0828 {Pyrococcus furiosus [TaxId: 2261]}
gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqaral
giplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevytp
awgrdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvag
eggefetfvldmplfkykivvdkakkvwepctssgkliieeahleskle

Sequence, based on observed residues (ATOM records):

>d3rjza_ c.26.2.1 (A:) Putative N-type ATP pyrophosphatase PF0828 {Pyrococcus furiosus [TaxId: 2261]}
gladvavlysggkdsnyalywaiknrfsvkflvtmvsetinanltdlqaralgiplvkgf
tevedlkrvlsglkiqgivagskyqrkriekvakelglevytpawgrdakeymrellnlg
fkimvvgvsaygldeswlgrildesaleelitlnekykvhvageggefetfvldmplfky
kivvdkakkvpctssgkliieeahleskle

Timeline for d3rjza_:

• d3rjza_ is new in SCOPe 2.01-stable
  
• d3rjza_ appears in SCOPe 2.02
  
• d3rjza_ appears in the current release, SCOPe 2.08, called d3rjza1