Lineage for d3risd_ (3ris D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927640Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2927641Protein automated matches [190230] (23 species)
    not a true protein
  7. 2927669Species Human (Homo sapiens) [TaxId:9606] [187072] (53 PDB entries)
  8. 2927726Domain d3risd_: 3ris D: [184993]
    automated match to d1ucha_
    complexed with gol, so4

Details for d3risd_

PDB Entry: 3ris (more details), 2.4 Å

PDB Description: Crystal structure of the catalytic domain of UCHL5, a proteasome-associated human deubiquitinating enzyme, reveals an unproductive form of the enzyme
PDB Compounds: (D:) Ubiquitin carboxyl-terminal hydrolase isozyme L5

SCOPe Domain Sequences for d3risd_:

Sequence, based on SEQRES records: (download)

>d3risd_ d.3.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
svvqdsrldtiffakqvinnacatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
glalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrlyeldglregpi
dlgacnqddwisavrpviekriqkysegeirfnlmaivsdrkmiyeqkiael

Sequence, based on observed residues (ATOM records): (download)

>d3risd_ d.3.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
svvqdsrldtiffakqvinnacatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
glalsnsdvirqvhnsfarqqmfefafhfvsyvpvngrlyeldglregpidlgacnqddw
isavrpviekriqkysegeirfnlmaivsdrkmiyeqkiael

SCOPe Domain Coordinates for d3risd_:

Click to download the PDB-style file with coordinates for d3risd_.
(The format of our PDB-style files is described here.)

Timeline for d3risd_: