Lineage for d1ll1_2 (1ll1 110-379)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99476Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
  4. 99477Superfamily a.86.1: Di-copper centre-containing domain [48056] (2 families) (S)
  5. 99478Family a.86.1.1: Hemocyanin middle domain [48057] (2 proteins)
  6. 99483Protein Hemocyanin [48058] (2 species)
  7. 99484Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48059] (4 PDB entries)
  8. 99488Domain d1ll1_2: 1ll1 110-379 [18499]
    Other proteins in same PDB: d1ll1_1, d1ll1_3

Details for d1ll1_2

PDB Entry: 1ll1 (more details), 2.55 Å

PDB Description: hydroxo bridge met form hemocyanin from limulus

SCOP Domain Sequences for d1ll1_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ll1_2 a.86.1.1 (110-379) Hemocyanin {Horseshoe crab (Limulus polyphemus)}
pvqeifpdkfipsaaineafkkilvdvgnildpeyrlayyredvginahhwhwhlvypst
wnpkyfgkkkdrkgelfyymhqqmcarydcerlsngmhrmlpfnnfdeplagyaphlthv
asgkyysprpdglklrdlgdieisemvrmrerildsihlgyvisedgshktldelhgtdi
lgalvessyesvnheyygnlhnwghvtmarihdpdgrfheepgvmsdtstslrdpifynw
hrfidnifheykntlk

SCOP Domain Coordinates for d1ll1_2:

Click to download the PDB-style file with coordinates for d1ll1_2.
(The format of our PDB-style files is described here.)

Timeline for d1ll1_2: