SCOPe 2.03: Domain d3rijd_: 3rij D:

Lineage for d3rijd_ (3rij D:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.116: YbaK/ProRS associated domain [55825] (1 superfamily)
   core: alpha-beta-alpha-beta(2)-(alpha-beta)2-alpha-beta(2)-alpha-beta; 3 layers; bifurcated mixed sheet

4. Superfamily d.116.1: YbaK/ProRS associated domain [55826] (2 families)

5. Family d.116.1.0: automated matches [191417] (1 protein)
   not a true family

6. Protein automated matches [190578] (4 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [188266] (3 PDB entries)

8. Domain d3rijd_: 3rij D: [184989]
   automated match to d1wdva_
   complexed with gol

Details for d3rijd_

PDB Entry: 3rij, 2.3 Å

PDB Description: epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins

PDB Compounds: (D:) SC_2cx5

SCOPe Domain Sequences for d3rijd_:

Sequence; same for both SEQRES and ATOM records:

>d3rijd_ d.116.1.0 (D:) automated matches {Thermus thermophilus [TaxId: 300852]}
slspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvyggekgay
lflvsgknrldlgkatrlvggplleadkwavaaltgfdaggvppvghntplpayldedll
gypevwaaggtpralfratpkellaltgaqvadlkeg

Timeline for d3rijd_:

• d3rijd_ first appeared in SCOPe 2.01
  
• d3rijd_ appears in SCOPe 2.02
  
• d3rijd_ appears in SCOPe 2.04
  
• d3rijd_ appears in the current release, SCOPe 2.08